ACCN1 Antikörper
-
- Target Alle ACCN1 Antikörper anzeigen
- ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACCN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV
- Top Product
- Discover our top product ACCN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACCN1 Blocking Peptide, catalog no. 33R-3197, is also available for use as a blocking control in assays to test for specificity of this ACCN1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))
- Andere Bezeichnung
- ACCN1 (ACCN1 Produkte)
- Hintergrund
- ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. ACCN1 may play a role in neurotransmission. In addition, a heteromeric association between ACCN1 and ACCN3 (variant 1) has been observed to co-assemble into proton-gated channels sensitive to gadolinium.
- Molekulargewicht
- 63 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-