KCNV1 Antikörper (N-Term)
-
- Target Alle KCNV1 Antikörper anzeigen
- KCNV1 (Potassium Channel, Subfamily V, Member 1 (KCNV1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNV1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNV1 antibody was raised against the N terminal of KCNV1
- Aufreinigung
- Affinity purified
- Immunogen
- KCNV1 antibody was raised using the N terminal of KCNV1 corresponding to a region with amino acids ALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAVVVASYRRPGALAAVP
- Top Product
- Discover our top product KCNV1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNV1 Blocking Peptide, catalog no. 33R-1332, is also available for use as a blocking control in assays to test for specificity of this KCNV1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNV1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNV1 (Potassium Channel, Subfamily V, Member 1 (KCNV1))
- Andere Bezeichnung
- KCNV1 (KCNV1 Produkte)
- Synonyme
- HNKA antikoerper, KCNB3 antikoerper, KV2.3 antikoerper, KV8.1 antikoerper, 2700023A03Rik antikoerper, vibe antikoerper, Kv8.1 antikoerper, potassium voltage-gated channel modifier subfamily V member 1 antikoerper, potassium channel, subfamily V, member 1 antikoerper, KCNV1 antikoerper, Kcnv1 antikoerper
- Hintergrund
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNV1 is a member of the potassium voltage-gated channel subfamily V. This protein is essentially present in the brain, and its role might be to inhibit the function of a particular class of outward rectifier potassium channel types.
- Molekulargewicht
- 56 kDa (MW of target protein)
-