KCNJ5 Antikörper (N-Term)

Produktnummer ABIN633707

Produktdetails anti-KCNJ5 Antikörper

Target: KCNJ5 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNJ5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNJ5 antibody was raised against the N terminal of KCNJ5

Aufreinigung: Affinity purified

Immunogen: KCNJ5 antibody was raised using the N terminal of KCNJ5 corresponding to a region with amino acids AGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNJ5 Blocking Peptide, catalog no. 33R-1190, is also available for use as a blocking control in assays to test for specificity of this KCNJ5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNJ5

Target: KCNJ5 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5))

Andere Bezeichnung: KCNJ5 (KCNJ5 Produkte)

Synonyme: CIR antikoerper, GIRK4 antikoerper, KATP1 antikoerper, KIR3.4 antikoerper, LQT13 antikoerper, Kir3.4 antikoerper, GIRK-4 antikoerper, KATP-1 antikoerper, potassium voltage-gated channel subfamily J member 5 antikoerper, potassium inwardly-rectifying channel, subfamily J, member 5 antikoerper, KCNJ5 antikoerper, Kcnj5 antikoerper

Hintergrund: Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. KCNJ5 is an integral membrane protein and inward-rectifier type potassium channel. KCNJ5, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. It may associate with two other G-protein-activated potassium channels to form a heteromultimeric pore-forming complex.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Notch Signalweg