KCNJ5 Antikörper (N-Term)
-
- Target Alle KCNJ5 Antikörper anzeigen
- KCNJ5 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNJ5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNJ5 antibody was raised against the N terminal of KCNJ5
- Aufreinigung
- Affinity purified
- Immunogen
- KCNJ5 antibody was raised using the N terminal of KCNJ5 corresponding to a region with amino acids AGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQ
- Top Product
- Discover our top product KCNJ5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNJ5 Blocking Peptide, catalog no. 33R-1190, is also available for use as a blocking control in assays to test for specificity of this KCNJ5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNJ5 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5))
- Andere Bezeichnung
- KCNJ5 (KCNJ5 Produkte)
- Synonyme
- CIR antikoerper, GIRK4 antikoerper, KATP1 antikoerper, KIR3.4 antikoerper, LQT13 antikoerper, Kir3.4 antikoerper, GIRK-4 antikoerper, KATP-1 antikoerper, potassium voltage-gated channel subfamily J member 5 antikoerper, potassium inwardly-rectifying channel, subfamily J, member 5 antikoerper, KCNJ5 antikoerper, Kcnj5 antikoerper
- Hintergrund
- Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. KCNJ5 is an integral membrane protein and inward-rectifier type potassium channel. KCNJ5, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. It may associate with two other G-protein-activated potassium channels to form a heteromultimeric pore-forming complex.
- Molekulargewicht
- 48 kDa (MW of target protein)
- Pathways
- Notch Signalweg
-