Bestrophin 3 Antikörper (N-Term)

Produktnummer ABIN633708

Produktdetails anti-Bestrophin 3 Antikörper

Target: Bestrophin 3 (BEST3)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Bestrophin 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BEST3 antibody was raised against the N terminal of BEST3

Aufreinigung: Affinity purified

Immunogen: BEST3 antibody was raised using the N terminal of BEST3 corresponding to a region with amino acids PLVYTQVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BEST3 Blocking Peptide, catalog no. 33R-7214, is also available for use as a blocking control in assays to test for specificity of this BEST3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BEST3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Bestrophin 3

Target: Bestrophin 3 (BEST3)

Andere Bezeichnung: BEST3 (BEST3 Produkte)

Synonyme: CG12327 antikoerper, Dmel\\CG12327 antikoerper, dbest3 antikoerper, best-3 antikoerper, BEST3 antikoerper, VMD2L3 antikoerper, Vmd2l3 antikoerper, mBest4 antikoerper, bestrophin-3 antikoerper, bestrophin 3 antikoerper, Bestrophin 3 antikoerper, BEST3 antikoerper, Best3 antikoerper, best3 antikoerper

Hintergrund: BEST3 belongs to the bestrophin family of anion channels, which includes BEST1, the gene mutant in vitelliform macular dystrophy, and 2 other BEST1-like genes, BEST2 and BEST4.

Molekulargewicht: 51 kDa (MW of target protein)