MCOLN1 Antikörper (N-Term)

Produktnummer ABIN633712

Produktdetails anti-MCOLN1 Antikörper

Target: MCOLN1 (Mucolipin 1 (MCOLN1))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCOLN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Mucolipin 1 antibody was raised against the N terminal of MCOLN1

Aufreinigung: Affinity purified

Immunogen: Mucolipin 1 antibody was raised using the N terminal of MCOLN1 corresponding to a region with amino acids FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Mucolipin 1 Blocking Peptide, catalog no. 33R-3049, is also available for use as a blocking control in assays to test for specificity of this Mucolipin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCOLN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MCOLN1

Target: MCOLN1 (Mucolipin 1 (MCOLN1))

Andere Bezeichnung: Mucolipin 1 (MCOLN1 Produkte)

Synonyme: mcoln1 antikoerper, mcoln1.1 antikoerper, zgc:63619 antikoerper, mln1 antikoerper, mucolipin-1 antikoerper, MCOLN1 antikoerper, MG-2 antikoerper, ML4 antikoerper, MLIV antikoerper, MST080 antikoerper, TRP-ML1 antikoerper, TRPM-L1 antikoerper, TRPML1 antikoerper, 2210015I05Rik antikoerper, mucolipidin antikoerper, mucolipin 1a antikoerper, mucolipin 1 antikoerper, mucolipin 1 L homeolog antikoerper, mcoln1a antikoerper, MCOLN1 antikoerper, mcoln1.L antikoerper, mcoln1 antikoerper, LOAG_04987 antikoerper, Mcoln1 antikoerper

Hintergrund: MCOLN1 encodes a protein that may be involved in calcium signaling and membrane trafficking in mucolipidosis IV.

Molekulargewicht: 64 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis