TRPM5 Antikörper (N-Term)
-
- Target Alle TRPM5 Antikörper anzeigen
- TRPM5 (Transient Receptor Potential Cation Channel, Subfamily M, Member 5 (TRPM5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRPM5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRPM5 antibody was raised against the N terminal of TRPM5
- Aufreinigung
- Affinity purified
- Immunogen
- TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV
- Top Product
- Discover our top product TRPM5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRPM5 Blocking Peptide, catalog no. 33R-2505, is also available for use as a blocking control in assays to test for specificity of this TRPM5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRPM5 (Transient Receptor Potential Cation Channel, Subfamily M, Member 5 (TRPM5))
- Andere Bezeichnung
- TRPM5 (TRPM5 Produkte)
- Synonyme
- LTRPC5 antikoerper, MTR1 antikoerper, 9430099A16Rik antikoerper, LTrpC-5 antikoerper, Ltrpc5 antikoerper, Mtr1 antikoerper, transient receptor potential cation channel subfamily M member 5 antikoerper, transient receptor potential cation channel, subfamily M, member 5 antikoerper, TRPM5 antikoerper, Trpm5 antikoerper, trpm5 antikoerper
- Hintergrund
- TRPM5 is a voltage-modulated Ca(2+)-activated, monovalent cation channel (VCAM) that mediates a transient membrane depolarization and plays a central role in taste transduction. It is activated by arachidonic acid in vitro. It may be involved in perception of bitter, sweet and umami tastes. It may also be involved in sensing semiochemicals.
- Molekulargewicht
- 131 kDa (MW of target protein)
-