CLCNKB Antikörper (C-Term)

Produktnummer ABIN633720

Produktdetails anti-CLCNKB Antikörper

Target: CLCNKB (Chloride Channel Kb (CLCNKB))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLCNKB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CLCNKB antibody was raised against the C terminal of CLCNKB

Aufreinigung: Affinity purified

Immunogen: CLCNKB antibody was raised using the C terminal of CLCNKB corresponding to a region with amino acids ILAAGCPTEPVTLKLSPETSLHEAHNLFELLNLHSLFVTSRGRAVGCVSW

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLCNKB Blocking Peptide, catalog no. 33R-4035, is also available for use as a blocking control in assays to test for specificity of this CLCNKB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCNKB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLCNKB

Target: CLCNKB (Chloride Channel Kb (CLCNKB))

Andere Bezeichnung: CLCNKB (CLCNKB Produkte)

Synonyme: CLCNKA antikoerper, CLCNKB antikoerper, DKFZp469N0132 antikoerper, CLCKB antikoerper, Clc-Ka antikoerper, Clck2 antikoerper, Clcnk1l antikoerper, ClC-K2L antikoerper, ClC-K2 antikoerper, ClC-Kb antikoerper, ClC-k antikoerper, clc-kb antikoerper, clckb antikoerper, clcnka-A antikoerper, clk-k2 antikoerper, x6clck antikoerper, xCIC-K antikoerper, xClC-K antikoerper, zgc:64141 antikoerper, Clcnkb antikoerper, chloride voltage-gated channel Kb antikoerper, chloride channel Kb antikoerper, chloride channel, voltage-sensitive Kb antikoerper, chloride channel, voltage-sensitive Kb L homeolog antikoerper, chloride channel K antikoerper, chloride channel protein ClC-Ka antikoerper, chloride channel protein ClC-Kb antikoerper, CLCNKB antikoerper, Clcnkb antikoerper, clcnkb.L antikoerper, clcnk antikoerper, LOC100017912 antikoerper, LOC100400180 antikoerper, LOC100590605 antikoerper, LOC100730738 antikoerper

Hintergrund: Chloride channel Kb (CLCNKB) is a member of the CLC family of voltage-gated chloride channels, which comprises at least 9 mammalian chloride channels. Each is believed to have 12 transmembrane domains and intracellular N and C termini. Mutations in CLCNKB result in the autosomal recessive Type III Bartter Syndrome. CLCNKA and CLCNKB are closely related (94% sequence identity), tightly linked (separated by 11 kb of genomic sequence) and are both expressed in mammalian kidney.

Molekulargewicht: 76 kDa (MW of target protein)