CLCNKA Antikörper (N-Term)
-
- Target Alle CLCNKA Antikörper anzeigen
- CLCNKA (Chloride Channel Ka (CLCNKA))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CLCNKA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CLCNKA antibody was raised against the N terminal of CLCNKA
- Aufreinigung
- Affinity purified
- Immunogen
- CLCNKA antibody was raised using the N terminal of CLCNKA corresponding to a region with amino acids MEELVGLREGFSGDPVTLQELWGPCPHIRRAIQGGLEWLKQKVFRLGEDW
- Top Product
- Discover our top product CLCNKA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CLCNKA Blocking Peptide, catalog no. 33R-5907, is also available for use as a blocking control in assays to test for specificity of this CLCNKA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCNKA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLCNKA (Chloride Channel Ka (CLCNKA))
- Andere Bezeichnung
- CLCNKA (CLCNKA Produkte)
- Synonyme
- CLCNKA antikoerper, C75963 antikoerper, CLC-K1 antikoerper, Clcnk1 antikoerper, CLCK1 antikoerper, ClC-K1 antikoerper, hClC-Ka antikoerper, CLCNKB antikoerper, chloride voltage-gated channel Ka antikoerper, chloride channel protein ClC-Ka antikoerper, chloride channel, voltage-sensitive Ka antikoerper, CLCNKA antikoerper, LOC703259 antikoerper, LOC100456543 antikoerper, LOC100593875 antikoerper, Clcnka antikoerper
- Hintergrund
- CLCNKA is a member of the CLC family of voltage-gated chloride channels. It is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. This gene is a member of the CLC family of voltage-gated chloride channels. The encoded protein is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. The gene is highly similar to CLCNKB, which is located 10 kb downstream from this gene. Multiple transcript variants encoding different isoforms have been found for this gene.
- Molekulargewicht
- 75 kDa (MW of target protein)
- Pathways
- Response to Water Deprivation
-