CHRNA4 Antikörper (N-Term)
-
- Target Alle CHRNA4 Antikörper anzeigen
- CHRNA4 (Cholinergic Receptor, Nicotinic, alpha 4 (CHRNA4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHRNA4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CHRNA4 antibody was raised against the N terminal of CHRNA4
- Aufreinigung
- Affinity purified
- Immunogen
- CHRNA4 antibody was raised using the N terminal of CHRNA4 corresponding to a region with amino acids AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT
- Top Product
- Discover our top product CHRNA4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHRNA4 Blocking Peptide, catalog no. 33R-1126, is also available for use as a blocking control in assays to test for specificity of this CHRNA4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHRNA4 (Cholinergic Receptor, Nicotinic, alpha 4 (CHRNA4))
- Andere Bezeichnung
- CHRNA4 (CHRNA4 Produkte)
- Hintergrund
- CHRNA4 is a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described.
- Molekulargewicht
- 67 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-