GRIK2 Antikörper (C-Term)

Produktnummer ABIN633773

Produktdetails anti-GRIK2 Antikörper

Target: GRIK2 (Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRIK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GRIK2 antibody was raised against the C terminal of GRIK2

Aufreinigung: Affinity purified

Immunogen: GRIK2 antibody was raised using the C terminal of GRIK2 corresponding to a region with amino acids TANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKIST

Anwendungsinformationen

Applikationshinweise: WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GRIK2 Blocking Peptide, catalog no. 33R-8980, is also available for use as a blocking control in assays to test for specificity of this GRIK2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GRIK2

Target: GRIK2 (Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2))

Andere Bezeichnung: GRIK2 (GRIK2 Produkte)

Synonyme: GRIK5 antikoerper, eaa4 antikoerper, glr6 antikoerper, gluk6 antikoerper, glur6 antikoerper, grik2 antikoerper, mrt6 antikoerper, GluR6 antikoerper, grik2-A antikoerper, EAA4 antikoerper, GLR6 antikoerper, GLUK6 antikoerper, GLUR6 antikoerper, GluK2 antikoerper, MRT6 antikoerper, AW124492 antikoerper, Glur-6 antikoerper, Glur6 antikoerper, Glurbeta2 antikoerper, GRIK2 antikoerper, glutamate ionotropic receptor kainate type subunit 2 antikoerper, glutamate receptor, ionotropic, kainate 2 L homeolog antikoerper, glutamate receptor, ionotropic, kainate 2 antikoerper, glutamate receptor, ionotropic, kainate 2 (beta 2) antikoerper, GRIK2 antikoerper, grik2.L antikoerper, grik2 antikoerper, Grik2 antikoerper

Hintergrund: This gene, GRIK2, encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus. The structure and function of the encoded protein is changed by RNA editing.

Molekulargewicht: 98 kDa (MW of target protein)

Pathways: Synaptic Membrane, Regulation of long-term Neuronal Synaptic Plasticity