GRIK2 Antikörper (C-Term)
-
- Target Alle GRIK2 Antikörper anzeigen
- GRIK2 (Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GRIK2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GRIK2 antibody was raised against the C terminal of GRIK2
- Aufreinigung
- Affinity purified
- Immunogen
- GRIK2 antibody was raised using the C terminal of GRIK2 corresponding to a region with amino acids TANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKIST
- Top Product
- Discover our top product GRIK2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GRIK2 Blocking Peptide, catalog no. 33R-8980, is also available for use as a blocking control in assays to test for specificity of this GRIK2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIK2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GRIK2 (Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2))
- Andere Bezeichnung
- GRIK2 (GRIK2 Produkte)
- Hintergrund
- This gene, GRIK2, encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus. The structure and function of the encoded protein is changed by RNA editing.
- Molekulargewicht
- 98 kDa (MW of target protein)
- Pathways
- Synaptic Membrane, Regulation of long-term Neuronal Synaptic Plasticity
-