ZACN Antikörper (N-Term)

Produktnummer ABIN633774

Produktdetails anti-ZACN Antikörper

Target: ZACN (Zinc Activated Ligand-Gated Ion Channel (ZACN))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZACN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LGICZ1 antibody was raised against the N terminal Of Lgicz1

Aufreinigung: Affinity purified

Immunogen: LGICZ1 antibody was raised using the N terminal Of Lgicz1 corresponding to a region with amino acids PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LGICZ1 Blocking Peptide, catalog no. 33R-7358, is also available for use as a blocking control in assays to test for specificity of this LGICZ1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGICZ1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZACN

Target: ZACN (Zinc Activated Ligand-Gated Ion Channel (ZACN))

Andere Bezeichnung: LGICZ1 (ZACN Produkte)

Synonyme: LGICZ1 antikoerper, L2 antikoerper, LGICZ antikoerper, ZAC antikoerper, ZAC1 antikoerper, zinc activated ion channel antikoerper, ZACN antikoerper

Hintergrund: LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels.LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Synaptic Membrane