KCNK6 Antikörper (N-Term)

Produktnummer ABIN633776

Produktdetails anti-KCNK6 Antikörper

Target: KCNK6 (Potassium Channel Subfamily K Member 6 (KCNK6))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNK6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNK6 antibody was raised against the n terminal of KCNK6

Aufreinigung: Affinity purified

Immunogen: KCNK6 antibody was raised using the N terminal of KCNK6 corresponding to a region with amino acids RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNK6 Blocking Peptide, catalog no. 33R-8027, is also available for use as a blocking control in assays to test for specificity of this KCNK6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNK6

Target: KCNK6 (Potassium Channel Subfamily K Member 6 (KCNK6))

Andere Bezeichnung: KCNK6 (KCNK6 Produkte)

Synonyme: Twik2 antikoerper, Twik-2 antikoerper, im:7152114 antikoerper, zgc:110418 antikoerper, K2p6.1 antikoerper, KCNK8 antikoerper, TOSS antikoerper, TWIK-2 antikoerper, TWIK2 antikoerper, D7Ertd764e antikoerper, Toss antikoerper, potassium channel, two pore domain subfamily K, member 6 antikoerper, potassium two pore domain channel subfamily K member 6 antikoerper, potassium channel, subfamily K, member 6 antikoerper, potassium inwardly-rectifying channel, subfamily K, member 6 antikoerper, Kcnk6 antikoerper, KCNK6 antikoerper, kcnk6 antikoerper

Hintergrund: KCNK6 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics.

Molekulargewicht: 34 kDa (MW of target protein)