GABRR2 Antikörper

Produktnummer ABIN633782

Produktdetails anti-GABRR2 Antikörper

Target: GABRR2 (gamma-aminobutyric Acid (GABA) Receptor, rho 2 (GABRR2))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GABRR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GABRR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GABRR2 Blocking Peptide, catalog no. 33R-8654, is also available for use as a blocking control in assays to test for specificity of this GABRR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GABRR2

Target: GABRR2 (gamma-aminobutyric Acid (GABA) Receptor, rho 2 (GABRR2))

Andere Bezeichnung: GABRR2 (GABRR2 Produkte)

Synonyme: si:dkey-181i3.1 antikoerper, gamma-aminobutyric acid type A receptor rho2 subunit antikoerper, gamma-aminobutyric acid (GABA) A receptor, rho 2b antikoerper, gamma-aminobutyric acid type A receptor rho 2 subunit antikoerper, gamma-aminobutyric acid (GABA) C receptor, subunit rho 2 antikoerper, gamma-aminobutyric acid receptor subunit rho-2 antikoerper, GABRR2 antikoerper, gabrr2b antikoerper, Gabrr2 antikoerper, LOC100653501 antikoerper

Hintergrund: GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR2 is a member of the rho subunit family and is a component of the GABA receptor complex.

Molekulargewicht: 54 kDa (MW of target protein)