GABRQ Antikörper

Produktnummer ABIN633787

Produktdetails anti-GABRQ Antikörper

Target: GABRQ (gamma-aminobutyric Acid (GABA) Receptor, theta (GABRQ))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GABRQ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GABRQ antibody was raised using a synthetic peptide corresponding to a region with amino acids KFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGG

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GABRQ Blocking Peptide, catalog no. 33R-4370, is also available for use as a blocking control in assays to test for specificity of this GABRQ antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRQ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GABRQ

Target: GABRQ (gamma-aminobutyric Acid (GABA) Receptor, theta (GABRQ))

Andere Bezeichnung: GABRQ (GABRQ Produkte)

Synonyme: THETA antikoerper, gamma-aminobutyric acid type A receptor theta subunit antikoerper, gamma-aminobutyric acid (GABA) A receptor, subunit theta antikoerper, GABRQ antikoerper, Gabrq antikoerper

Hintergrund: The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, theta subunit. GABRQ gene is mapped to chromosome Xq28 in a cluster including the genes encoding the alpha 3 and epsilon subunits of the same receptor.

Molekulargewicht: 72 kDa (MW of target protein)