KCNK1 Antikörper (Middle Region)
-
- Target Alle KCNK1 Antikörper anzeigen
- KCNK1 (Potassium Channel Subfamily K Member 1 (KCNK1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNK1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNK1 antibody was raised against the middle region of KCNK1
- Aufreinigung
- Affinity purified
- Immunogen
- KCNK1 antibody was raised using the middle region of KCNK1 corresponding to a region with amino acids EDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
- Top Product
- Discover our top product KCNK1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNK1 Blocking Peptide, catalog no. 33R-2326, is also available for use as a blocking control in assays to test for specificity of this KCNK1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNK1 (Potassium Channel Subfamily K Member 1 (KCNK1))
- Andere Bezeichnung
- KCNK1 (KCNK1 Produkte)
- Synonyme
- AI788889 antikoerper, TWIK-1 antikoerper, DPK antikoerper, HOHO antikoerper, K2P1 antikoerper, K2p1.1 antikoerper, KCNO1 antikoerper, TWIK1 antikoerper, Twik antikoerper, k2p1.1 antikoerper, twik-1 antikoerper, twik1 antikoerper, rabKCNK1 antikoerper, im:7150627 antikoerper, kcnk1 antikoerper, zgc:165664 antikoerper, potassium channel, subfamily K, member 1 antikoerper, potassium two pore domain channel subfamily K member 1 antikoerper, potassium channel, two pore domain subfamily K, member 1 L homeolog antikoerper, potassium channel, subfamily K, member 1a antikoerper, Kcnk1 antikoerper, KCNK1 antikoerper, kcnk1.L antikoerper, kcnk1a antikoerper
- Hintergrund
- KCNK1 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK1 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.
- Molekulargewicht
- 38 kDa (MW of target protein)
-