GABRE Antikörper
-
- Target Alle GABRE Antikörper anzeigen
- GABRE (gamma-aminobutyric Acid (GABA) A Receptor, epsilon (GABRE))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GABRE Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GABRE antibody was raised using a synthetic peptide corresponding to a region with amino acids DVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDH
- Top Product
- Discover our top product GABRE Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GABRE Blocking Peptide, catalog no. 33R-2229, is also available for use as a blocking control in assays to test for specificity of this GABRE antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRE antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GABRE (gamma-aminobutyric Acid (GABA) A Receptor, epsilon (GABRE))
- Andere Bezeichnung
- GABRE (GABRE Produkte)
- Synonyme
- GABRE antikoerper, gamma-aminobutyric acid type A receptor epsilon subunit antikoerper, gamma-aminobutyric acid (GABA) A receptor, subunit epsilon antikoerper, GABRE antikoerper, Gabre antikoerper
- Hintergrund
- GABRE belongs to the ligand-gated ionic channel family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-