KCNK15 Antikörper (Middle Region)
-
- Target Alle KCNK15 Antikörper anzeigen
- KCNK15 (Potassium Channel Subfamily K Member 15 (KCNK15))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNK15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNK15 antibody was raised against the middle region of KCNK15
- Aufreinigung
- Affinity purified
- Immunogen
- KCNK15 antibody was raised using the middle region of KCNK15 corresponding to a region with amino acids ARSVGSASVFCHVHKLERCARDNLGFSPPSSPGVVRGGQAPRPGARWKSI
- Top Product
- Discover our top product KCNK15 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNK15 Blocking Peptide, catalog no. 33R-1496, is also available for use as a blocking control in assays to test for specificity of this KCNK15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK15 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNK15 (Potassium Channel Subfamily K Member 15 (KCNK15))
- Andere Bezeichnung
- KCNK15 (KCNK15 Produkte)
- Synonyme
- zgc:171568 antikoerper, K2p15.1 antikoerper, KCNK11 antikoerper, KCNK14 antikoerper, KT3.3 antikoerper, TASK-5 antikoerper, TASK5 antikoerper, dJ781B1.1 antikoerper, potassium two pore domain channel subfamily K member 15 antikoerper, potassium channel, subfamily K, member 15 antikoerper, Potassium channel subfamily K member 15 antikoerper, KCNK15 antikoerper, kcnk15 antikoerper, kcnkf antikoerper, Kcnk15 antikoerper
- Hintergrund
- KCNK15 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK15 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.
- Molekulargewicht
- 36 kDa (MW of target protein)
-