KCNK5 Antikörper (C-Term)

Produktnummer ABIN633797

Produktdetails anti-KCNK5 Antikörper

Target: KCNK5 (Potassium Channel, Subfamily K, Member 5 (KCNK5))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNK5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNK5 antibody was raised against the C terminal of KCNK5

Aufreinigung: Affinity purified

Immunogen: KCNK5 antibody was raised using the C terminal of KCNK5 corresponding to a region with amino acids TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSES

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNK5 Blocking Peptide, catalog no. 33R-9078, is also available for use as a blocking control in assays to test for specificity of this KCNK5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNK5

Target: KCNK5 (Potassium Channel, Subfamily K, Member 5 (KCNK5))

Andere Bezeichnung: KCNK5 (KCNK5 Produkte)

Synonyme: K2p5.1 antikoerper, TASK-2 antikoerper, TASK2 antikoerper, kcnk5 antikoerper, zgc:63921 antikoerper, task2 antikoerper, k2p5.1 antikoerper, task-2 antikoerper, zgc:123271 antikoerper, potassium two pore domain channel subfamily K member 5 antikoerper, potassium channel, subfamily K, member 5 antikoerper, potassium channel, subfamily K, member 5b antikoerper, potassium channel, two pore domain subfamily K, member 5 S homeolog antikoerper, potassium channel, subfamily K, member 5a antikoerper, KCNK5 antikoerper, Kcnk5 antikoerper, kcnk5b antikoerper, kcnk5.S antikoerper, kcnk5a antikoerper

Hintergrund: KCNK5 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK5 is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport.

Molekulargewicht: 55 kDa (MW of target protein)