KCNK5 Antikörper (C-Term)
-
- Target Alle KCNK5 Antikörper anzeigen
- KCNK5 (Potassium Channel, Subfamily K, Member 5 (KCNK5))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNK5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNK5 antibody was raised against the C terminal of KCNK5
- Aufreinigung
- Affinity purified
- Immunogen
- KCNK5 antibody was raised using the C terminal of KCNK5 corresponding to a region with amino acids TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSES
- Top Product
- Discover our top product KCNK5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNK5 Blocking Peptide, catalog no. 33R-9078, is also available for use as a blocking control in assays to test for specificity of this KCNK5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNK5 (Potassium Channel, Subfamily K, Member 5 (KCNK5))
- Andere Bezeichnung
- KCNK5 (KCNK5 Produkte)
- Hintergrund
- KCNK5 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK5 is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport.
- Molekulargewicht
- 55 kDa (MW of target protein)
-