KCNK13 Antikörper (C-Term)

Produktnummer ABIN633799

Produktdetails anti-KCNK13 Antikörper

Target: KCNK13 (Potassium Channel Subfamily K Member 13 (KCNK13))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNK13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: KCNK13 antibody was raised against the C terminal of KCNK13

Aufreinigung: Affinity purified

Immunogen: KCNK13 antibody was raised using the C terminal of KCNK13 corresponding to a region with amino acids GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA

Anwendungsinformationen

Applikationshinweise: WB: 0.12 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNK13 Blocking Peptide, catalog no. 33R-3237, is also available for use as a blocking control in assays to test for specificity of this KCNK13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNK13

Target: KCNK13 (Potassium Channel Subfamily K Member 13 (KCNK13))

Andere Bezeichnung: KCNK13 (KCNK13 Produkte)

Synonyme: BB085247 antikoerper, F730021E22Rik antikoerper, Gm1570 antikoerper, Gm1685 antikoerper, K2p13.1 antikoerper, THIK-1 antikoerper, THIK1 antikoerper, prdx1 antikoerper, kcnk13 antikoerper, si:ch211-173b9.3 antikoerper, zgc:171694 antikoerper, potassium channel, subfamily K, member 13 antikoerper, potassium two pore domain channel subfamily K member 13 antikoerper, potassium channel subfamily K member 13 antikoerper, potassium channel, subfamily K, member 13b antikoerper, potassium channel, subfamily K, member 13a antikoerper, Kcnk13 antikoerper, KCNK13 antikoerper, Tsp_07890 antikoerper, kcnk13b antikoerper, kcnk13a antikoerper

Hintergrund: KCNK13 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming domains. The product of this gene is an open channel that can be stimulated by arachidonic acid.

Molekulargewicht: 45 kDa (MW of target protein)