MTR Antikörper (C-Term)
-
- Target Alle MTR Antikörper anzeigen
- MTR (5-Methyltetrahydrofolate-Homocysteine Methyltransferase (MTR))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MTR Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MTR antibody was raised against the C terminal of MTR
- Kreuzreaktivität
- Human
- Aufreinigung
- Affinity purified
- Immunogen
- MTR antibody was raised using the C terminal of MTR corresponding to a region with amino acids GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL
- Top Product
- Discover our top product MTR Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MTR Blocking Peptide, catalog no. 33R-3557, is also available for use as a blocking control in assays to test for specificity of this MTR antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTR (5-Methyltetrahydrofolate-Homocysteine Methyltransferase (MTR))
- Andere Bezeichnung
- MTR (MTR Produkte)
- Hintergrund
- MTR is the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G.
- Molekulargewicht
- 140 kDa (MW of target protein)
- Pathways
- Methionine Biosynthetic Process
-