MTR Antikörper (C-Term)

Produktnummer ABIN633804

Produktdetails anti-MTR Antikörper

Target: MTR (5-Methyltetrahydrofolate-Homocysteine Methyltransferase (MTR))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MTR antibody was raised against the C terminal of MTR

Kreuzreaktivität: Human

Aufreinigung: Affinity purified

Immunogen: MTR antibody was raised using the C terminal of MTR corresponding to a region with amino acids GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTR Blocking Peptide, catalog no. 33R-3557, is also available for use as a blocking control in assays to test for specificity of this MTR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTR

Target: MTR (5-Methyltetrahydrofolate-Homocysteine Methyltransferase (MTR))

Andere Bezeichnung: MTR (MTR Produkte)

Synonyme: HMAG antikoerper, MS antikoerper, cblG antikoerper, AI894170 antikoerper, D830038K18Rik antikoerper, methioninesynthase antikoerper, 5-methyltetrahydrofolate-homocysteine methyltransferase antikoerper, MTR antikoerper, Mtr antikoerper

Hintergrund: MTR is the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G.

Molekulargewicht: 140 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process