DPYSL3 Antikörper (Middle Region)
-
- Target Alle DPYSL3 Antikörper anzeigen
- DPYSL3 (Dihydropyrimidinase-Like 3 (DPYSL3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DPYSL3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DPYSL3 antibody was raised against the middle region of DPYSL3
- Aufreinigung
- Affinity purified
- Immunogen
- DPYSL3 antibody was raised using the middle region of DPYSL3 corresponding to a region with amino acids VFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSA
- Top Product
- Discover our top product DPYSL3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DPYSL3 Blocking Peptide, catalog no. 33R-9522, is also available for use as a blocking control in assays to test for specificity of this DPYSL3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPYSL3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DPYSL3 (Dihydropyrimidinase-Like 3 (DPYSL3))
- Andere Bezeichnung
- DPYSL3 (DPYSL3 Produkte)
- Synonyme
- CRMP4A antikoerper, CRMP4B antikoerper, dpysl3 antikoerper, DRP-3 antikoerper, MGC69487 antikoerper, dpysl3-b antikoerper, crmp4 antikoerper, CRMP-4 antikoerper, xCRMP4 antikoerper, DRP-3-B antikoerper, DPYSL3 antikoerper, CRMP4 antikoerper, DRP3 antikoerper, LCRMP antikoerper, ULIP antikoerper, ULIP-1 antikoerper, TUC4 antikoerper, Ulip antikoerper, Ulip1 antikoerper, Crmp4 antikoerper, TUC-4b antikoerper, drp-3 antikoerper, drp3 antikoerper, lcrmp antikoerper, nsp1 antikoerper, tuc-4 antikoerper, tuc4 antikoerper, ulip antikoerper, ulip-1 antikoerper, dihydropyrimidinase like 3 antikoerper, dihydropyrimidinase like 3 L homeolog antikoerper, dihydropyrimidinase-like 3 antikoerper, dihydropyrimidinase like 3 S homeolog antikoerper, DPYSL3 antikoerper, dpysl3 antikoerper, dpysl3.L antikoerper, Dpysl3 antikoerper, dpysl3.S antikoerper
- Hintergrund
- DPYSL3 is necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. DPYSL3 plays a role in axon guidance, neuronal growth cone collapse and cell migration.
- Molekulargewicht
- 62 kDa (MW of target protein)
-