TMOD2 Antikörper
-
- Target Alle TMOD2 Antikörper anzeigen
- TMOD2 (Tropomodulin 2 (TMOD2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMOD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Tropomodulin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDRED
- Top Product
- Discover our top product TMOD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Tropomodulin 2 Blocking Peptide, catalog no. 33R-4840, is also available for use as a blocking control in assays to test for specificity of this Tropomodulin 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMOD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMOD2 (Tropomodulin 2 (TMOD2))
- Andere Bezeichnung
- Tropomodulin 2 (TMOD2 Produkte)
- Synonyme
- zgc:86648 antikoerper, N-Tmod antikoerper, NTMOD antikoerper, N-TMOD antikoerper, tropomodulin 2 antikoerper, tmod2 antikoerper, Tmod2 antikoerper, TMOD2 antikoerper
- Hintergrund
- TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling
-