HEY1 Antikörper (N-Term)
-
- Target Alle HEY1 Antikörper anzeigen
- HEY1 (Ha-Ry/enhancer-of-Split Related with YRPW Motif 1 (HEY1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HEY1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HEY1 antibody was raised against the N terminal of HEY1
- Aufreinigung
- Affinity purified
- Immunogen
- HEY1 antibody was raised using the N terminal of HEY1 corresponding to a region with amino acids ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG
- Top Product
- Discover our top product HEY1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HEY1 Blocking Peptide, catalog no. 33R-1335, is also available for use as a blocking control in assays to test for specificity of this HEY1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEY1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HEY1 (Ha-Ry/enhancer-of-Split Related with YRPW Motif 1 (HEY1))
- Andere Bezeichnung
- HEY1 (HEY1 Produkte)
- Synonyme
- BHLHb31 antikoerper, CHF2 antikoerper, HERP2 antikoerper, HESR1 antikoerper, HRT-1 antikoerper, OAF1 antikoerper, AI316788 antikoerper, AI414254 antikoerper, HRT1 antikoerper, Herp2 antikoerper, Hesr1 antikoerper, bHLHb31 antikoerper, hesr-1 antikoerper, id:ibd1292 antikoerper, zgc:110572 antikoerper, bc8 antikoerper, chf2 antikoerper, herp2 antikoerper, hesr1 antikoerper, hrt1 antikoerper, oaf1 antikoerper, xbc8 antikoerper, hes related family bHLH transcription factor with YRPW motif 1 antikoerper, hairy/enhancer-of-split related with YRPW motif 1 antikoerper, hes-related family bHLH transcription factor with YRPW motif 1 antikoerper, hes related family bHLH transcription factor with YRPW motif 1 S homeolog antikoerper, HEY1 antikoerper, Hey1 antikoerper, hey1 antikoerper, hey1.S antikoerper
- Hintergrund
- Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation.
- Molekulargewicht
- 32 kDa (MW of target protein)
- Pathways
- Tube Formation
-