ube3a Antikörper (Middle Region)
-
- Target Alle ube3a Antikörper anzeigen
- ube3a (Ubiquitin Protein Ligase E3A (ube3a))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ube3a Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UBE3 A antibody was raised against the middle region of Ube3
- Aufreinigung
- Affinity purified
- Immunogen
- UBE3 A antibody was raised using the middle region of Ube3 corresponding to a region with amino acids AKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
- Top Product
- Discover our top product ube3a Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UBE3A Blocking Peptide, catalog no. 33R-1304, is also available for use as a blocking control in assays to test for specificity of this UBE3A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ube3a (Ubiquitin Protein Ligase E3A (ube3a))
- Andere Bezeichnung
- UBE3A (ube3a Produkte)
- Synonyme
- ANCR antikoerper, AS antikoerper, E6-AP antikoerper, EPVE6AP antikoerper, HPVE6A antikoerper, DDBDRAFT_0188760 antikoerper, DDBDRAFT_0302447 antikoerper, DDB_0188760 antikoerper, DDB_0302447 antikoerper, ube3a antikoerper, im:7140733 antikoerper, zgc:92173 antikoerper, 4732496B02 antikoerper, 5830462N02Rik antikoerper, A130086L21Rik antikoerper, Hpve6a antikoerper, mKIAA4216 antikoerper, As antikoerper, CG6190 antikoerper, Dmel\\CG6190 antikoerper, Dube3a antikoerper, UBE3A antikoerper, dUBE3A antikoerper, das antikoerper, dube3A antikoerper, dube3a antikoerper, MGC69536 antikoerper, UME3A antikoerper, ubiquitin protein ligase E3A antikoerper, ubiquitin-protein ligase E3A antikoerper, Ubiquitin protein ligase E3A antikoerper, ubiquitin protein ligase E3A (human papilloma virus E6-associated protein, Angelman syndrome) S homeolog antikoerper, ubiquitin protein ligase E3A (human papilloma virus E6-associated protein, Angelman syndrome) antikoerper, UBE3A antikoerper, ube3a antikoerper, LOC100194730 antikoerper, Ube3a antikoerper, ube3a.S antikoerper, Eint_040430 antikoerper
- Hintergrund
- UBE3A is an E3 ubiquitin-protein ligase, part of the ubiquitin protein degradation system. This imprinted gene is maternally expressed in brain and biallelically expressed in other tissues. Maternally inherited deletion of this gene causes Angelman Syndrome, characterized by severe motor and intellectual retardation, ataxia, hypotonia, epilepsy, absence of speech, and characteristic facies. The protein also interacts with the E6 protein of human papillomavirus types 16 and 18, resulting in ubiquitination and proteolysis of tumor protein p53.
- Molekulargewicht
- 101 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway
-