CRMP1 Antikörper (C-Term)

Produktnummer ABIN633822

Produktdetails anti-CRMP1 Antikörper

Target: CRMP1 (Collapsin Response Mediator Protein 1 (CRMP1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRMP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CRMP1 antibody was raised against the C terminal of CRMP1

Aufreinigung: Affinity purified

Immunogen: CRMP1 antibody was raised using the C terminal of CRMP1 corresponding to a region with amino acids SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITS

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CRMP1 Blocking Peptide, catalog no. 33R-8838, is also available for use as a blocking control in assays to test for specificity of this CRMP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRMP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRMP1

Target: CRMP1 (Collapsin Response Mediator Protein 1 (CRMP1))

Andere Bezeichnung: CRMP1 (CRMP1 Produkte)

Synonyme: CRMP1 antikoerper, crmp1 antikoerper, MGC145930 antikoerper, CRMP 1 antikoerper, CRMP-1 antikoerper, PCRMP 1 antikoerper, PCRMP-1 antikoerper, PCRMP1 antikoerper, PfCRMP-1 antikoerper, DPYSL1 antikoerper, DRP-1 antikoerper, DRP1 antikoerper, ULIP-3 antikoerper, Dpysl1 antikoerper, Ulip3 antikoerper, CRMP1B antikoerper, collapsin response mediator protein 1 antikoerper, dihydropyrimidinase-related protein 1 antikoerper, cysteine repeat modular protein 1, putative antikoerper, collapsin response mediator protein 1 L homeolog antikoerper, CRMP1 antikoerper, crmp1 antikoerper, LOC100350067 antikoerper, PfCRMP1 antikoerper, Crmp1 antikoerper, crmp1.L antikoerper

Hintergrund: CRMP1 is a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development.

Molekulargewicht: 62 kDa (MW of target protein)