MPPED2 Antikörper (N-Term)
-
- Target Alle MPPED2 Antikörper anzeigen
- MPPED2 (metallophosphoesterase Domain Containing 2 (MPPED2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MPPED2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MPPED2 antibody was raised against the N terminal of MPPED2
- Aufreinigung
- Affinity purified
- Immunogen
- MPPED2 antibody was raised using the N terminal of MPPED2 corresponding to a region with amino acids RFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHT
- Top Product
- Discover our top product MPPED2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MPPED2 Blocking Peptide, catalog no. 33R-7906, is also available for use as a blocking control in assays to test for specificity of this MPPED2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPPED2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MPPED2 (metallophosphoesterase Domain Containing 2 (MPPED2))
- Andere Bezeichnung
- MPPED2 (MPPED2 Produkte)
- Synonyme
- 239fb antikoerper, 239FB antikoerper, C11orf8 antikoerper, 239Fb antikoerper, 2700082O15Rik antikoerper, AV354767 antikoerper, AW060960 antikoerper, C11orf8h antikoerper, brpl antikoerper, cb1097 antikoerper, fk34e08 antikoerper, wu:fk34e08 antikoerper, zgc:56667 antikoerper, metallophosphoesterase domain containing 2 S homeolog antikoerper, metallophosphoesterase domain containing 2 antikoerper, metallophosphoesterase domain containing 2b antikoerper, mpped2.S antikoerper, MPPED2 antikoerper, Mpped2 antikoerper, mpped2 antikoerper
- Hintergrund
- The specific function of MPPED2 is not yet known.
- Molekulargewicht
- 33 kDa (MW of target protein)
-