Cardiotrophin 1 Antikörper (N-Term)
-
- Target Alle Cardiotrophin 1 (CTF1) Antikörper anzeigen
- Cardiotrophin 1 (CTF1)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Cardiotrophin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Cardiotrophin 1 antibody was raised against the N terminal of CTF1
- Aufreinigung
- Affinity purified
- Immunogen
- Cardiotrophin 1 antibody was raised using the N terminal of CTF1 corresponding to a region with amino acids MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQ
- Top Product
- Discover our top product CTF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cardiotrophin 1 Blocking Peptide, catalog no. 33R-6489, is also available for use as a blocking control in assays to test for specificity of this Cardiotrophin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cardiotrophin 1 (CTF1)
- Andere Bezeichnung
- Cardiotrophin 1 (CTF1 Produkte)
- Synonyme
- CTF1 antikoerper, ct1 antikoerper, ct-1 antikoerper, ctf2 antikoerper, CT-1 antikoerper, CT1 antikoerper, cardiotrophin 1 antikoerper, cardiotrophin-1 antikoerper, CTF1 antikoerper, ctf1 antikoerper, Ctf1 antikoerper, LOC100736818 antikoerper
- Hintergrund
- CTF1 induces cardiac myocyte hypertrophy in vitro. It binds to and activates the ILST/gp130 receptor. It belongs to the IL-6 superfamily.
- Molekulargewicht
- 21 kDa (MW of target protein)
- Pathways
- JAK-STAT Signalweg
-