PHYH Antikörper (Middle Region)
-
- Target Alle PHYH Antikörper anzeigen
- PHYH (Phytanoyl-CoA 2-Hydroxylase (PHYH))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PHYH Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PHYH antibody was raised against the middle region of PHYH
- Aufreinigung
- Affinity purified
- Immunogen
- PHYH antibody was raised using the middle region of PHYH corresponding to a region with amino acids EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI
- Top Product
- Discover our top product PHYH Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PHYH Blocking Peptide, catalog no. 33R-2503, is also available for use as a blocking control in assays to test for specificity of this PHYH antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHYH antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHYH (Phytanoyl-CoA 2-Hydroxylase (PHYH))
- Andere Bezeichnung
- PHYH (PHYH Produkte)
- Synonyme
- zgc:110203 antikoerper, LN1 antikoerper, LNAP1 antikoerper, PAHX antikoerper, PHYH1 antikoerper, RD antikoerper, AI256161 antikoerper, AI265699 antikoerper, Lnap1 antikoerper, phytanoyl-CoA 2-hydroxylase antikoerper, phytanoyl-CoA hydroxylase-like antikoerper, phytanoyl-CoA hydroxylase antikoerper, PHYH antikoerper, LOC478001 antikoerper, phyh antikoerper, Phyh antikoerper
- Hintergrund
- This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-