CHERP Antikörper (Middle Region)

Produktnummer ABIN633834

Produktdetails anti-CHERP Antikörper

Target: CHERP (Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHERP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CHERP antibody was raised against the middle region of CHERP

Aufreinigung: Affinity purified

Immunogen: CHERP antibody was raised using the middle region of CHERP corresponding to a region with amino acids EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHERP Blocking Peptide, catalog no. 33R-2664, is also available for use as a blocking control in assays to test for specificity of this CHERP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHERP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHERP

Target: CHERP (Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP))

Andere Bezeichnung: CHERP (CHERP Produkte)

Hintergrund: CHERP is involved in calcium homeostasis, growth and proliferation.

Molekulargewicht: 104 kDa (MW of target protein)