CHERP Antikörper (Middle Region)
-
- Target Alle CHERP Antikörper anzeigen
- CHERP (Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHERP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CHERP antibody was raised against the middle region of CHERP
- Aufreinigung
- Affinity purified
- Immunogen
- CHERP antibody was raised using the middle region of CHERP corresponding to a region with amino acids EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD
- Top Product
- Discover our top product CHERP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHERP Blocking Peptide, catalog no. 33R-2664, is also available for use as a blocking control in assays to test for specificity of this CHERP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHERP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHERP (Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP))
- Andere Bezeichnung
- CHERP (CHERP Produkte)
- Hintergrund
- CHERP is involved in calcium homeostasis, growth and proliferation.
- Molekulargewicht
- 104 kDa (MW of target protein)
-