APOE Antikörper (N-Term)
-
- Target Alle APOE Antikörper anzeigen
- APOE (Apolipoprotein E (APOE))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APOE Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ApoE antibody was raised against the N terminal of APOE
- Aufreinigung
- Affinity purified
- Immunogen
- ApoE antibody was raised using the N terminal of APOE corresponding to a region with amino acids KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF
- Top Product
- Discover our top product APOE Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ApoE Blocking Peptide, catalog no. 33R-4716, is also available for use as a blocking control in assays to test for specificity of this ApoE antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOE antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOE (Apolipoprotein E (APOE))
- Andere Bezeichnung
- ApoE (APOE Produkte)
- Synonyme
- ad2 antikoerper, apoprotein antikoerper, im:7036787 antikoerper, wu:fb69a05 antikoerper, zgc:110064 antikoerper, apoe antikoerper, AI255918 antikoerper, AD2 antikoerper, LDLCQ5 antikoerper, LPG antikoerper, APOEA antikoerper, Apo-E antikoerper, apolipoprotein E antikoerper, apolipoprotein Ea antikoerper, apoe antikoerper, apoea antikoerper, Apoe antikoerper, APOE antikoerper
- Hintergrund
- Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.
- Molekulargewicht
- 34 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size, Lipid Metabolism
-