Glutathione Reductase Antikörper (N-Term)

Produktnummer ABIN633841

Produktdetails anti-Glutathione Reductase Antikörper

Target: Glutathione Reductase (GSR)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Glutathione Reductase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GSR antibody was raised against the N terminal of GSR

Aufreinigung: Affinity purified

Immunogen: GSR antibody was raised using the N terminal of GSR corresponding to a region with amino acids PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GSR Blocking Peptide, catalog no. 33R-7387, is also available for use as a blocking control in assays to test for specificity of this GSR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Glutathione Reductase

Target: Glutathione Reductase (GSR)

Andere Bezeichnung: GSR (GSR Produkte)

Synonyme: GR antikoerper, ATGR2 antikoerper, EMB2360 antikoerper, glutathione reductase antikoerper, AI325518 antikoerper, D8Ertd238e antikoerper, Gr-1 antikoerper, Gr1 antikoerper, DDBDRAFT_0168952 antikoerper, DDBDRAFT_0231410 antikoerper, DDB_0168952 antikoerper, DDB_0231410 antikoerper, 2151 antikoerper, CG2151 antikoerper, DTR antikoerper, Dm-TrxR antikoerper, DmTR antikoerper, DmTrx antikoerper, DmTrxR antikoerper, DmTrxR-1 antikoerper, Dmel\\CG2151 antikoerper, Gr antikoerper, Trx antikoerper, TrxR antikoerper, TrxR-1 antikoerper, Trxr1 antikoerper, anon-WO03040301.185 antikoerper, anon-WO03040301.187 antikoerper, dTrxR antikoerper, dmtrxr-1 antikoerper, gr antikoerper, l(1)G0154 antikoerper, l(1)G0379 antikoerper, l(1)G0477 antikoerper, l(1)G0481 antikoerper, trxr-1 antikoerper, gor1 antikoerper, glutathione reductase, gro-2 antikoerper, glutathione reductase antikoerper, glutathione-disulfide reductase antikoerper, GR; GRase antikoerper, mitochondrial glutathione reductase Pgr1 antikoerper, Glutathione reductase (GR) (GRase) antikoerper, Thioredoxin reductase-1 antikoerper, glutathione-disulfide reductase family protein antikoerper, glutathione reductase 1 antikoerper, GR antikoerper, gor antikoerper, GSR antikoerper, GSR1 antikoerper, Gsr_2 antikoerper, Gsr antikoerper, GSHR1 antikoerper, gsr antikoerper, LbGR antikoerper, pgr1 antikoerper, GSHR2 antikoerper, GLR2 antikoerper, Bcen_2392 antikoerper, RPE_1989 antikoerper, HCAG_02219 antikoerper, SJAG_01162 antikoerper, Trxr-1 antikoerper, PF14_0192 antikoerper, POPTR_0001s14480g antikoerper, gsr1 antikoerper

Hintergrund: GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Cell RedoxHomeostasis