ECHDC2 Antikörper (Middle Region)

Produktnummer ABIN633843

Produktdetails anti-ECHDC2 Antikörper

Target: ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ECHDC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ECHDC2 antibody was raised against the middle region of ECHDC2

Aufreinigung: Affinity purified

Immunogen: ECHDC2 antibody was raised using the middle region of ECHDC2 corresponding to a region with amino acids FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ECHDC2 Blocking Peptide, catalog no. 33R-3118, is also available for use as a blocking control in assays to test for specificity of this ECHDC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ECHDC2

Target: ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))

Andere Bezeichnung: ECHDC2 (ECHDC2 Produkte)

Synonyme: NV16396 antikoerper, id:ibd1032 antikoerper, wu:fc83b02 antikoerper, zgc:56321 antikoerper, zgc:85763 antikoerper, RGD1308525 antikoerper, 1300017C12Rik antikoerper, 2610009M20Rik antikoerper, D4Ertd765e antikoerper, enoyl-CoA hydratase domain containing 2 antikoerper, methylglutaconyl-CoA hydratase, mitochondrial antikoerper, enoyl CoA hydratase domain containing 2 antikoerper, enoyl Coenzyme A hydratase domain containing 2 antikoerper, ECHDC2 antikoerper, echdc2 antikoerper, LOC100121877 antikoerper, Echdc2 antikoerper

Hintergrund: ECHDC2 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC2 remains unknown.

Molekulargewicht: 28 kDa (MW of target protein)