FGA Antikörper (Middle Region)
-
- Target Alle FGA Antikörper anzeigen
- FGA (Fibrinogen alpha Chain (FGA))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FGA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Fibrinogen Alpha antibody was raised against the middle region of FGA
- Aufreinigung
- Affinity purified
- Immunogen
- Fibrinogen Alpha antibody was raised using the middle region of FGA corresponding to a region with amino acids SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAK
- Top Product
- Discover our top product FGA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Fibrinogen Alpha Blocking Peptide, catalog no. 33R-8855, is also available for use as a blocking control in assays to test for specificity of this Fibrinogen Alpha antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FGA (Fibrinogen alpha Chain (FGA))
- Andere Bezeichnung
- Fibrinogen alpha (FGA Produkte)
- Synonyme
- Fib2 antikoerper, ENSMUSG00000059807 antikoerper, Fib antikoerper, Ac1873 antikoerper, Fba5e antikoerper, fibrinogen alpha chain antikoerper, FGA antikoerper, Fga antikoerper, LOC698244 antikoerper
- Hintergrund
- FGA is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis.
- Molekulargewicht
- 66 kDa (MW of target protein)
-