PGS1 Antikörper (C-Term)

Produktnummer ABIN633847

Produktdetails anti-PGS1 Antikörper

Target: PGS1 (Phosphatidylglycerophosphate Synthase 1 (PGS1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PGS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: PGS1 antibody was raised against the C terminal of PGS1

Aufreinigung: Affinity purified

Immunogen: PGS1 antibody was raised using the C terminal of PGS1 corresponding to a region with amino acids QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTP

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PGS1 Blocking Peptide, catalog no. 33R-7584, is also available for use as a blocking control in assays to test for specificity of this PGS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PGS1

Target: PGS1 (Phosphatidylglycerophosphate Synthase 1 (PGS1))

Andere Bezeichnung: PGS1 (PGS1 Produkte)

Synonyme: 2610019F11Rik antikoerper, 4933424M23Rik antikoerper, SAF antikoerper, RGD1305052 antikoerper, phosphatidylglycerophosphate synthase 1 antikoerper, phosphatidylglycerophosphate synthase 1 S homeolog antikoerper, PGS1 antikoerper, Pgs1 antikoerper, pgs1.S antikoerper, pgs1 antikoerper

Hintergrund: PGS1 functions in the biosynthesis of the anionic phospholipids phosphatidylglycerol and cardiolipin.

Molekulargewicht: 63 kDa (MW of target protein)