SDF2 Antikörper (Middle Region)
-
- Target Alle SDF2 Antikörper anzeigen
- SDF2 (Stromal Cell Derived Factor 2 (SDF2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SDF2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SDF2 antibody was raised against the middle region of SDF2
- Aufreinigung
- Affinity purified
- Immunogen
- SDF2 antibody was raised using the middle region of SDF2 corresponding to a region with amino acids RDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEG
- Top Product
- Discover our top product SDF2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SDF2 Blocking Peptide, catalog no. 33R-7844, is also available for use as a blocking control in assays to test for specificity of this SDF2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDF2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SDF2 (Stromal Cell Derived Factor 2 (SDF2))
- Andere Bezeichnung
- SDF2 (SDF2 Produkte)
- Synonyme
- AI853825 antikoerper, fk23f01 antikoerper, wu:fk23f01 antikoerper, zgc:66291 antikoerper, stromal cell derived factor 2 antikoerper, stromal cell-derived factor 2 antikoerper, stromal cell derived factor 2 L homeolog antikoerper, sdf2 antikoerper, Sdf2 antikoerper, sdf2.L antikoerper, SDF2 antikoerper
- Hintergrund
- SDF2 is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.
- Molekulargewicht
- 21 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-