MST1 Antikörper
-
- Target Alle MST1 Antikörper anzeigen
- MST1 (Macrophage Stimulating 1 (Hepatocyte Growth Factor-Like) (MST1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MST1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- MST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE
- Top Product
- Discover our top product MST1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MST1 Blocking Peptide, catalog no. 33R-8329, is also available for use as a blocking control in assays to test for specificity of this MST1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MST1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MST1 (Macrophage Stimulating 1 (Hepatocyte Growth Factor-Like) (MST1))
- Andere Bezeichnung
- MST1 (MST1 Produkte)
- Synonyme
- D3F15S2 antikoerper, DNF15S2 antikoerper, HGFL antikoerper, MSP antikoerper, NF15S2 antikoerper, E2F2 antikoerper, D3F15S2h antikoerper, D9H3F15S2 antikoerper, DNF15S2h antikoerper, Hgfl antikoerper, HGF1/MSP antikoerper, E1A antikoerper, XHL antikoerper, d3f15s2 antikoerper, dnf15s2 antikoerper, hgfl antikoerper, msp antikoerper, mst1 antikoerper, nf15s2 antikoerper, macrophage stimulating 1 antikoerper, macrophage stimulating 1 (hepatocyte growth factor-like) antikoerper, serine/threonine kinase 4 antikoerper, macrophage stimulating 1 L homeolog antikoerper, MST1 antikoerper, Mst1 antikoerper, STK4 antikoerper, mst1.L antikoerper
- Hintergrund
- MST1 belongs to the peptidase S1 family, plasminogen subfamily. It contains 4 kringle domains, 1 PAN domain and 1 peptidase S1 domain. MST1 probably has no proteolytic activity, since crucial characteristic of serine proteases catalytic sites are not conserved.
- Molekulargewicht
- 80 kDa (MW of target protein)
-