UGCGL2 Antikörper (Middle Region)
-
- Target Alle UGCGL2 (UGT2) Antikörper anzeigen
- UGCGL2 (UGT2) (UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGT2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UGCGL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UGCGL2 antibody was raised against the middle region of µgCGL2
- Aufreinigung
- Affinity purified
- Immunogen
- UGCGL2 antibody was raised using the middle region of µgCGL2 corresponding to a region with amino acids LCNNPKTKESKLKAAARIVPEWVEYDAEIRQLLDHLENKKQDTILTHDEL
- Top Product
- Discover our top product UGT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UGCGL2 Blocking Peptide, catalog no. 33R-4827, is also available for use as a blocking control in assays to test for specificity of this µgCGL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCGL2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UGCGL2 (UGT2) (UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGT2))
- Andere Bezeichnung
- UGCGL2 (UGT2 Produkte)
- Synonyme
- UGCGL2 antikoerper, ugcgl2 antikoerper, im:7146988 antikoerper, wu:fi13a08 antikoerper, HUGT2 antikoerper, UGT2 antikoerper, 1810064L21Rik antikoerper, 3110001A05Rik antikoerper, 3110027P15Rik antikoerper, A230065J02Rik antikoerper, AW047562 antikoerper, Ugcgl2 antikoerper, UDP-glucose glycoprotein glucosyltransferase 2 antikoerper, UGGT2 antikoerper, uggt2 antikoerper, Uggt2 antikoerper
- Hintergrund
- UGCGL2 recognises glycoproteins with minor folding defects. UGCGL2 reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognised by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation.
- Molekulargewicht
- 172 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-