Arylsulfatase A Antikörper (N-Term)

Produktnummer ABIN633858

Produktdetails anti-Arylsulfatase A Antikörper

Target: Arylsulfatase A (ARSA)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Arylsulfatase A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ARSA antibody was raised against the N terminal of ARSA

Aufreinigung: Affinity purified

Immunogen: ARSA antibody was raised using the N terminal of ARSA corresponding to a region with amino acids DLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARSA Blocking Peptide, catalog no. 33R-2042, is also available for use as a blocking control in assays to test for specificity of this ARSA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Arylsulfatase A

Target: Arylsulfatase A (ARSA)

Andere Bezeichnung: ARSA (ARSA Produkte)

Synonyme: ARSA antikoerper, zgc:101575 antikoerper, arsa antikoerper, AS-A antikoerper, ASA antikoerper, AW212749 antikoerper, As-2 antikoerper, As2 antikoerper, TISP73 antikoerper, MLD antikoerper, mld antikoerper, arylsulfatase A antikoerper, arylsulfatase antikoerper, arylsulfatase A, gene 1 S homeolog antikoerper, ARSA antikoerper, arsa antikoerper, arsA antikoerper, RB6599 antikoerper, Arsa antikoerper, arsa.1.S antikoerper

Hintergrund: The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Multiple alternatively spliced transcript variants, one of which encodes a distinct protein, have been described for this gene.

Molekulargewicht: 56 kDa (MW of target protein)