NOMO1 Antikörper (N-Term)

Produktnummer ABIN633863

Produktdetails anti-NOMO1 Antikörper

Target: NOMO1 (NODAL Modulator 1 (NOMO1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NOMO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NOMO1 antibody was raised against the N terminal of NOMO1

Aufreinigung: Affinity purified

Immunogen: NOMO1 antibody was raised using the N terminal of NOMO1 corresponding to a region with amino acids DGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NOMO1 Blocking Peptide, catalog no. 33R-1965, is also available for use as a blocking control in assays to test for specificity of this NOMO1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOMO1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NOMO1

Target: NOMO1 (NODAL Modulator 1 (NOMO1))

Andere Bezeichnung: NOMO1 (NOMO1 Produkte)

Synonyme: Nomo antikoerper, PM5 antikoerper, D7Ertd156e antikoerper, pM5 antikoerper, RGD1305240 antikoerper, NOMO2 antikoerper, DKFZP459L1733 antikoerper, Nomo1 antikoerper, NODAL modulator 1 antikoerper, nodal modulator 1 antikoerper, NOMO1 antikoerper, Nomo1 antikoerper, LOC515570 antikoerper, LOC714226 antikoerper, LOC100025365 antikoerper, LOC100174326 antikoerper, LOC100408200 antikoerper, LOC100464689 antikoerper, LOC100544619 antikoerper, LOC100626015 antikoerper, LOC454345 antikoerper, LOC489992 antikoerper, LOC100713781 antikoerper

Hintergrund: NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE).

Molekulargewicht: 134 kDa (MW of target protein)