NOMO1 Antikörper (C-Term)
-
- Target Alle NOMO1 Antikörper anzeigen
- NOMO1 (NODAL Modulator 1 (NOMO1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NOMO1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NOMO1 antibody was raised against the C terminal of NOMO1
- Aufreinigung
- Affinity purified
- Immunogen
- NOMO1 antibody was raised using the C terminal of NOMO1 corresponding to a region with amino acids QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASD
- Top Product
- Discover our top product NOMO1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NOMO1 Blocking Peptide, catalog no. 33R-7500, is also available for use as a blocking control in assays to test for specificity of this NOMO1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOMO1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NOMO1 (NODAL Modulator 1 (NOMO1))
- Andere Bezeichnung
- NOMO1 (NOMO1 Produkte)
- Hintergrund
- NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE).
- Molekulargewicht
- 134 kDa (MW of target protein)
-