LAIR2 Antikörper (N-Term)

Produktnummer ABIN633870

Produktdetails anti-LAIR2 Antikörper

Target: LAIR2 (Leukocyte-Associated Immunoglobulin-Like Receptor 2 (LAIR2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LAIR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LAIR2 antibody was raised against the N terminal of LAIR2

Aufreinigung: Affinity purified

Immunogen: LAIR2 antibody was raised using the N terminal of LAIR2 corresponding to a region with amino acids SPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVISPGSHVTFMCRG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LAIR2 Blocking Peptide, catalog no. 33R-8677, is also available for use as a blocking control in assays to test for specificity of this LAIR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAIR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LAIR2

Target: LAIR2 (Leukocyte-Associated Immunoglobulin-Like Receptor 2 (LAIR2))

Andere Bezeichnung: LAIR2 (LAIR2 Produkte)

Synonyme: CD306 antikoerper, leukocyte associated immunoglobulin like receptor 2 antikoerper, LAIR2 antikoerper

Hintergrund: LAIR2 is a member of the immunoglobulin superfamily. It was identified by its similarity to LAIR1, an inhibitory receptor present on mononuclear leukocytes. This gene maps to a region of 19q13.4, termed the leukocyte receptor cluster, which contains 29 genes in the immunoglobulin superfamily, including LAIR1. The function of this protein is unknown, although it is thought to be secreted and may help modulate mucosal tolerance. Two transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 16 kDa (MW of target protein)