AGXT2 Antikörper (N-Term)
-
- Target Alle AGXT2 Antikörper anzeigen
- AGXT2 (Alanine Glyoxylate Aminotransferase 2 (AGXT2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AGXT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AGXT2 antibody was raised against the N terminal of AGXT2
- Aufreinigung
- Affinity purified
- Immunogen
- AGXT2 antibody was raised using the N terminal of AGXT2 corresponding to a region with amino acids TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK
- Top Product
- Discover our top product AGXT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AGXT2 Blocking Peptide, catalog no. 33R-9305, is also available for use as a blocking control in assays to test for specificity of this AGXT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGXT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AGXT2 (Alanine Glyoxylate Aminotransferase 2 (AGXT2))
- Andere Bezeichnung
- AGXT2 (AGXT2 Produkte)
- Synonyme
- AGT2 antikoerper, DAIBAT antikoerper, AI303810 antikoerper, AI663818 antikoerper, T19P19.50 antikoerper, T19P19_50 antikoerper, alanine:glyoxylate aminotransferase 2 antikoerper, im:7153274 antikoerper, zgc:114195 antikoerper, alanine--glyoxylate aminotransferase 2 antikoerper, alanine-glyoxylate aminotransferase 2 antikoerper, alanine:glyoxylate aminotransferase 2 antikoerper, AGXT2 antikoerper, Agxt2 antikoerper, AGT2 antikoerper, agxt2 antikoerper
- Hintergrund
- The protein encoded by this gene is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor.
- Molekulargewicht
- 52 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-