GPX3 Antikörper

Produktnummer ABIN633878

Produktdetails anti-GPX3 Antikörper

Target: GPX3 (Glutathione Peroxidase 3 (Plasma) (GPX3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPX3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GPX3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPX3 Blocking Peptide, catalog no. 33R-1870, is also available for use as a blocking control in assays to test for specificity of this GPX3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPX3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPX3

Target: GPX3 (Glutathione Peroxidase 3 (Plasma) (GPX3))

Andere Bezeichnung: GPX3 (GPX3 Produkte)

Synonyme: GPX3 antikoerper, DKFZp469D1932 antikoerper, AA960521 antikoerper, EGPx antikoerper, GPx antikoerper, GSHPx-3 antikoerper, GSHPx-P antikoerper, GPx-3 antikoerper, GPx-P antikoerper, Gpxp antikoerper, glutathione peroxidase 3 antikoerper, gpx3 antikoerper, GPX3 antikoerper, Gpx3 antikoerper

Hintergrund: GPX3 belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis