CRISP1 Antikörper (N-Term)

Produktnummer ABIN633879

Produktdetails anti-CRISP1 Antikörper

Target: CRISP1 (Cysteine-Rich Secretory Protein 1 (CRISP1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRISP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CRISP1 antibody was raised against the N terminal of CRISP1

Aufreinigung: Affinity purified

Immunogen: CRISP1 antibody was raised using the N terminal of CRISP1 corresponding to a region with amino acids LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CRISP1 Blocking Peptide, catalog no. 33R-5093, is also available for use as a blocking control in assays to test for specificity of this CRISP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRISP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRISP1

Target: CRISP1 (Cysteine-Rich Secretory Protein 1 (CRISP1))

Andere Bezeichnung: CRISP1 (CRISP1 Produkte)

Synonyme: AEGL1 antikoerper, ARP antikoerper, CRISP-1 antikoerper, HSCRISP1D antikoerper, HSCRISP1G antikoerper, HUMARP antikoerper, AW324342 antikoerper, Aeg1 antikoerper, AEG antikoerper, crisp-1 antikoerper, cysteine rich secretory protein 1 antikoerper, cysteine-rich secretory protein 1 antikoerper, CRISP1 antikoerper, Crisp1 antikoerper

Hintergrund: Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. CRISP1 is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface.

Molekulargewicht: 27 kDa (MW of target protein)