ACRV1 Antikörper (N-Term)
-
- Target Alle ACRV1 Antikörper anzeigen
- ACRV1 (Acrosomal Vesicle Protein 1 (ACRV1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACRV1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACRV1 antibody was raised against the N terminal of ACRV1
- Aufreinigung
- Affinity purified
- Immunogen
- ACRV1 antibody was raised using the N terminal of ACRV1 corresponding to a region with amino acids MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS
- Top Product
- Discover our top product ACRV1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACRV1 Blocking Peptide, catalog no. 33R-6263, is also available for use as a blocking control in assays to test for specificity of this ACRV1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACRV1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACRV1 (Acrosomal Vesicle Protein 1 (ACRV1))
- Andere Bezeichnung
- ACRV1 (ACRV1 Produkte)
- Hintergrund
- ACRV1 is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.
- Molekulargewicht
- 29 kDa (MW of target protein)
-