ACRV1 Antikörper (N-Term)

Produktnummer ABIN633880

Produktdetails anti-ACRV1 Antikörper

Target: ACRV1 (Acrosomal Vesicle Protein 1 (ACRV1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACRV1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACRV1 antibody was raised against the N terminal of ACRV1

Aufreinigung: Affinity purified

Immunogen: ACRV1 antibody was raised using the N terminal of ACRV1 corresponding to a region with amino acids MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACRV1 Blocking Peptide, catalog no. 33R-6263, is also available for use as a blocking control in assays to test for specificity of this ACRV1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACRV1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACRV1

Target: ACRV1 (Acrosomal Vesicle Protein 1 (ACRV1))

Andere Bezeichnung: ACRV1 (ACRV1 Produkte)

Synonyme: ACRV1 antikoerper, D11S4365 antikoerper, SP-10 antikoerper, SPACA2 antikoerper, Msa63 antikoerper, Sp10 antikoerper, acrosomal vesicle protein 1 antikoerper, ACRV1 antikoerper, Acrv1 antikoerper

Hintergrund: ACRV1 is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.

Molekulargewicht: 29 kDa (MW of target protein)