OXCT1 Antikörper (N-Term)

Produktnummer ABIN633892

Produktdetails anti-OXCT1 Antikörper

Target: OXCT1 (3-Oxoacid CoA Transferase 1 (OXCT1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OXCT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OXCT1 antibody was raised against the N terminal of OXCT1

Aufreinigung: Affinity purified

Immunogen: OXCT1 antibody was raised using the N terminal of OXCT1 corresponding to a region with amino acids TLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OXCT1 Blocking Peptide, catalog no. 33R-9158, is also available for use as a blocking control in assays to test for specificity of this OXCT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXCT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OXCT1

Target: OXCT1 (3-Oxoacid CoA Transferase 1 (OXCT1))

Andere Bezeichnung: OXCT1 (OXCT1 Produkte)

Synonyme: OXCT antikoerper, oxct1 antikoerper, zgc:92003 antikoerper, wu:fj36f06 antikoerper, wu:fj48g08 antikoerper, OXCT1 antikoerper, oxct antikoerper, scot antikoerper, SCOT antikoerper, 2610008O03Rik antikoerper, Oxct antikoerper, Oxct2a antikoerper, Scot-s antikoerper, 3-oxoacid CoA-transferase 1 antikoerper, 3-oxoacid CoA transferase 1a antikoerper, 3-oxoacid CoA transferase 1 antikoerper, 3-oxoacid CoA-transferase 1 L homeolog antikoerper, succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial antikoerper, OXCT1 antikoerper, oxct1a antikoerper, oxct1 antikoerper, Oxct1 antikoerper, oxct1.L antikoerper, MONBRDRAFT_35053 antikoerper, LOC100414476 antikoerper

Hintergrund: OXCT1 is a member of the 3-oxoacid CoA-transferase gene family. It is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis