BCKDHA Antikörper (N-Term)

Produktnummer ABIN633903

Produktdetails anti-BCKDHA Antikörper

Target: BCKDHA (Branched Chain Keto Acid Dehydrogenase E1, alpha Polypeptide (BCKDHA))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BCKDHA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BCKDHA antibody was raised against the N terminal of BCKDHA

Aufreinigung: Affinity purified

Immunogen: BCKDHA antibody was raised using the N terminal of BCKDHA corresponding to a region with amino acids NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BCKDHA Blocking Peptide, catalog no. 33R-6914, is also available for use as a blocking control in assays to test for specificity of this BCKDHA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCKDHA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BCKDHA

Target: BCKDHA (Branched Chain Keto Acid Dehydrogenase E1, alpha Polypeptide (BCKDHA))

Andere Bezeichnung: BCKDHA (BCKDHA Produkte)

Synonyme: wu:fd20d04 antikoerper, zgc:110049 antikoerper, BCKDE1A antikoerper, MSU antikoerper, MSUD1 antikoerper, OVD1A antikoerper, BCKDA antikoerper, E1a antikoerper, 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial antikoerper, branched chain keto acid dehydrogenase E1, alpha polypeptide antikoerper, 2-oxoisovalerate dehydrogenase alpha subunit (branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) (BCKDH E1-alpha) (BCKDE1A) antikoerper, branched chain ketoacid dehydrogenase E1, alpha polypeptide antikoerper, LOC704978 antikoerper, bckdha antikoerper, BCKDHA antikoerper, BckdhA antikoerper, Bckdha antikoerper

Hintergrund: The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).

Molekulargewicht: 50 kDa (MW of target protein)