GFRA2 Antikörper (C-Term)
-
- Target Alle GFRA2 Antikörper anzeigen
- GFRA2 (GDNF Family Receptor alpha 2 (GFRA2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GFRA2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GFRA2 antibody was raised against the C terminal of GFRA2
- Aufreinigung
- Affinity purified
- Immunogen
- GFRA2 antibody was raised using the C terminal of GFRA2 corresponding to a region with amino acids NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK
- Top Product
- Discover our top product GFRA2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GFRA2 Blocking Peptide, catalog no. 33R-6924, is also available for use as a blocking control in assays to test for specificity of this GFRA2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GFRA2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GFRA2 (GDNF Family Receptor alpha 2 (GFRA2))
- Andere Bezeichnung
- GFRA2 (GFRA2 Produkte)
- Synonyme
- GDNFRB antikoerper, NRTNR-ALPHA antikoerper, NTNRA antikoerper, RETL2 antikoerper, TRNR2 antikoerper, Retl2 antikoerper, NTNRALPHA antikoerper, ntnra antikoerper, retl2 antikoerper, trnr2 antikoerper, gdnfrb antikoerper, nrtnr-alpha antikoerper, gfra2 antikoerper, GDNF family receptor alpha 2 antikoerper, glial cell line derived neurotrophic factor family receptor alpha 2 antikoerper, GDNF family receptor alpha 2a antikoerper, GFRA2 antikoerper, Gfra2 antikoerper, gfra2 antikoerper, gfra2a antikoerper
- Hintergrund
- Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. GFRA2 is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This encoded protein acts preferentially as a receptor for NTN compared to its other family member, GDNF family receptor alpha 1.
- Molekulargewicht
- 47 kDa (MW of target protein)
-