Albumin Antikörper (Middle Region)
-
- Target Alle Albumin (ALB) Antikörper anzeigen
- Albumin (ALB)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Albumin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Albumin antibody was raised against the middle region of ALB
- Aufreinigung
- Affinity purified
- Immunogen
- Albumin antibody was raised using the middle region of ALB corresponding to a region with amino acids LSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKE
- Top Product
- Discover our top product ALB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Albumin Blocking Peptide, catalog no. 33R-5421, is also available for use as a blocking control in assays to test for specificity of this Albumin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Sortilin and prosaposin localize to detergent-resistant membrane microdomains." in: Experimental cell research, Vol. 315, Issue 2, pp. 240-7, (2008) (PubMed).
: "The analysis and characterisation of immuno-unreactive urinary albumin in healthy volunteers." in: Clinical biochemistry, Vol. 39, Issue 2, pp. 143-51, (2006) (PubMed).
: "
-
Sortilin and prosaposin localize to detergent-resistant membrane microdomains." in: Experimental cell research, Vol. 315, Issue 2, pp. 240-7, (2008) (PubMed).
-
- Target
- Albumin (ALB)
- Andere Bezeichnung
- Albumin (ALB Produkte)
- Synonyme
- PRO0883 antikoerper, PRO0903 antikoerper, PRO1341 antikoerper, ALB antikoerper, CSA antikoerper, Alb-1 antikoerper, Alb1 antikoerper, Albza antikoerper, LOC100136344 antikoerper, alb-a antikoerper, alb-b antikoerper, albumin antikoerper, serum albumin 1 antikoerper, albumin S homeolog antikoerper, ALB antikoerper, Alb antikoerper, LOC100136344 antikoerper, alb.S antikoerper
- Hintergrund
- Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin.
- Molekulargewicht
- 67 kDa (MW of target protein)
- Pathways
- Lipid Metabolism
-