UGCGL2 Antikörper (N-Term)

Produktnummer ABIN633912

Produktdetails anti-UGCGL2 Antikörper

Target: UGCGL2 (UGT2) (UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGT2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGCGL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UGCGL2 antibody was raised against the N terminal of µgCGL2

Aufreinigung: Affinity purified

Immunogen: UGCGL2 antibody was raised using the N terminal of µgCGL2 corresponding to a region with amino acids KHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGCGL2 Blocking Peptide, catalog no. 33R-4422, is also available for use as a blocking control in assays to test for specificity of this µgCGL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCGL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGCGL2

Target: UGCGL2 (UGT2) (UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGT2))

Andere Bezeichnung: UGCGL2 (UGT2 Produkte)

Synonyme: UGCGL2 antikoerper, ugcgl2 antikoerper, im:7146988 antikoerper, wu:fi13a08 antikoerper, HUGT2 antikoerper, UGT2 antikoerper, 1810064L21Rik antikoerper, 3110001A05Rik antikoerper, 3110027P15Rik antikoerper, A230065J02Rik antikoerper, AW047562 antikoerper, Ugcgl2 antikoerper, UDP-glucose glycoprotein glucosyltransferase 2 antikoerper, UGGT2 antikoerper, uggt2 antikoerper, Uggt2 antikoerper

Hintergrund: UGCGL2 recognises glycoproteins with minor folding defects. UGCGL2 reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognised by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation.

Molekulargewicht: 172 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom